Conus striatus putative S-superfamily conotoxin precursor, mRNA, partial cds (N00948) Nucleic Acid Card

General Information
Name Conus striatus putative S-superfamily conotoxin precursor, mRNA, partial cds
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
ggtgattgctcttgcgagggccagatttgtaaatgcggtt
atagagtcagtcctgggaagtcaggatgcgcgtgtacttg
tagaaatgccaaa
tgaatcatttaactcgttgaaagattt
taaaaaaatccagagctatatgttgcagaaaaaccgaaga
ctctgagacttctcgtaataaatccgtaaagattaaaaaa
aaaaaaaaaaaaaaaaaaaaaaaa
Sequence translation GDCSCEGQICKCGYRVSPGKSGCACTCRNAK

References
Pi,C., Liu,Y., Peng,C., Jiang,X., Liu,J., Xu,B., Yu,X., Yu,Y., Jiang,X., Wang,L., Dong,M., Chen,S. and Xu,A.L. (2006) Analysis of expressed sequence tags from the venom ducts of Conus striatus: focusing on the expression profile of conotoxins Biochimie 88:131-140

Internal links
Proteins Encoded conotoxin precursor

External links
Ncbi
GenBank DQ117950

Tools