Conus marmoreus MaIr94P mRNA, complete cds (N00965) Nucleic Acid Card

General Information
Name Conus marmoreus MaIr94P mRNA, complete cds
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
catcgtcaag
atgaaactgacgtgcgtgttgatcatcacc
gtgctgttcctgacggcctgtcaacttactgcagctggta
actccagagataagcaggaggatcctgtagtgaggtcgag
tggtgaggtgcagagatccgaggacatcaagttggccaag
agatgcttagaatccggtagcctctgttttgctgggtatg
ggcacagttcctgctgcagtggtgcatgtcttgactacgg
aggcttaggcgttggcgcatgcaga
taaaactggtctgac
gtctgaaatttccccctctgtccttgatcctcttttgcct
gattcatccatacctatgtgtggtcatgaaccactcagta
ccttcacctctggtggcttctgaggacgtacatcaaaata
aaaccacactgcaatgaataaaaaaaaaaaaaaaaaaaaa
aaaaaaaaaaaaaaaa
Sequence translation MKLTCVLIITVLFLTACQLTAAGNSRDKQEDPVVRSSGEV
QRSEDIKLAKRCLESGSLCFAGYGHSSCCSGACLDYGGLG
VGACR

References
Luo,S., Zhangsun,D., Zhang,B. and Lin,Q. (0) Novel O-superfamily conotoxins, and their coding polynucleotides and use
Luo,S., Zhangsun,D., Lin,Q., Xie,L., Wu,Y. and Zhu,X. (2006) Sequence diversity of O-superfamily conopetides from Conus marmoreus native to Hainan Peptides 27:3058-3068

Internal links
Proteins Encoded MaIr94 precursor

External links
Ncbi
GenBank DQ141172

Tools