Conus regius alpha conotoxin-RgIA precursor, gene, partial cds (N00979) Nucleic Acid Card

General Information
Name Conus regius alpha conotoxin-RgIA precursor, gene, partial cds
Organism Conus regius
Organism Diet vermivorous
Organism Clade XVII
Organism Region Eastern Pacific
Notes

Sequence
tctaataaaaggaagaatgccgcaatgcttgacatgatcg
ctcaacacgccataaggggttgctgttccgatcctcgctg
tagatatagatgtcgt
tgaagacgctgctgctgctccagg
accctctgaaccacgacgt
Sequence translation SNKRKNAAMLDMIAQHAIRGCCSDPRCRYRCR

References
Ellison,M., Haberlandt,C., Gomez-Casati,M.E., Watkins,M., Elgoyhen,A.B., McIntosh,J.M. and Olivera,B.M. (2006) Alpha-RgIA: a novel conotoxin that specifically and potently blocks the alpha9alpha10 nAChR Biochemistry 45:1511-1517

Internal links
Proteins Encoded RgIA precursor

External links
Ncbi
GenBank DQ239610

Tools