Conus litteratus T-superfamily conotoxin lt5e precursor, mRNA, complete cds (N00983) Nucleic Acid Card

General Information
Name Conus litteratus T-superfamily conotoxin lt5e precursor, mRNA, complete cds
Organism Conus litteratus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
gattttggcgaatacacctggcaggtactcaacgaatttc
aggacacattcttttcacctggacacgggaaactgacaac
aagcaga
atgcgctgtctccaagtcttcatcatttttctg
ctgctgattccatctccacccagcgttgatgcccaacgga
agaccaaagatgatgtgcccctggcatctttccatgataa
tgcaaagcgaaccctgaaaagactttggaacaaacgctcg
tgctgcccacgagaatttttatgctgtctaaga
tgaaagg
aaatgactttggatgagactcctgcgaactgtcccttgat
gtgagatttggaaagcagactgttacttctgcgtgtgttc
gtggaatttcgaatggtcgttaacaacatgctgccacttg
caagctactatctctttgtcctttcatctgtggaactgga
tgacctaacaactgaaatgtcatggaaatttttcaatggg
tatacactattacaatgtattcggaaattgcatcgtttgg
actttttgaaatatttttcaaaatgtagtcagtgtttttt
ttcctttggaaaggtcctttgtggttatatatttcagtat
gttatgctttgcacacaagctatagaatgctatatttctt
tttgttaccacatcaatgatggggccagaaatcattggtt
ttggtctatgtaattatgacctgtatttagtgccatattg
attgcattttcaacgttgaatgcttaatctgcaaagagaa
agtatttgatcgactaataaagacttgcatggcacagtta
aaaaa
Sequence translation MRCLQVFIIFLLLIPSPPSVDAQRKTKDDVPLASFHDNAK
RTLKRLWNKRSCCPREFLCCLR

References
Pi,C., Liu,J., Peng,C., Liu,Y., Jiang,X., Zhao,Y., Tang,S., Wang,L., Dong,M., Chen,S. and Xu,A. (2006) Diversity and evolution of conotoxins based on gene expression profiling of Conus litteratus Genomics 88:809-819

Internal links
Proteins Encoded Lt5e precursor

External links
Ncbi
GenBank DQ345354

Tools