Conus litteratus T-superfamily conotoxin lt5j precursor, mRNA, complete cds (N00992) Nucleic Acid Card

General Information
Name Conus litteratus T-superfamily conotoxin lt5j precursor, mRNA, complete cds
Organism Conus litteratus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
ggctcttcactctgcagcctccatctgccttgaagccgtc
agccctccccatcgggtgttcagtgtttaccaacagccac
gcctgccaaccgatcctttctctgcgctacgtggcacttt
gcagtgtgagaacaagaatctgactacaagcaga
atgctg
tgtcttccggtcttcatcatccttcttctgttggcttcac
ctgcagctccaaagtctttggaaacgagaatccagaacga
tttgattcgcgcaggccttacagatgccgatctgaaaacc
gaaaaaggcttccttagcggcctactcaacgtggccggca
gtgtgtgctgcaaggttgataccagttgctgttctagcca
a
taatcaagatgctttaaagtatggctgactttggaaccg
acacctccaaactgtacccggatatgagatgtaaaaaagc
agactgtttcttttgcacatgctcgtgtgggttgaaacag
tcatctaatatacgctgccatttgcattgtcatgctctgc
gtttattcacagaactgcatacctaattagattaaatgtc
ttggaaattgaactcattttctgcacagtatagtcagtga
ccaaccagtcatacttcaaatatttctgattatctaaact
gcttcaacatctttttatgtgtgctttttgtgacattttc
gtttcgctaggcgtctgcagtacaatatattgtctccttt
tcttcagcatgaagaaaaactctctgggcaaggatcatca
taattcctagctttaagggacttccttcggtgttgaatgg
tcgacatgttacaaagagtggtcaaaagactaataaaccg
cttgcattgaaaaa
Sequence translation MLCLPVFIILLLLASPAAPKSLETRIQNDLIRAGLTDADL
KTEKGFLSGLLNVAGSVCCKVDTSCCSSQ

References
Pi,C., Liu,J., Peng,C., Liu,Y., Jiang,X., Zhao,Y., Tang,S., Wang,L., Dong,M., Chen,S. and Xu,A. (2006) Diversity and evolution of conotoxins based on gene expression profiling of Conus litteratus Genomics 88:809-819

Internal links
Proteins Encoded Lt5j precursor

External links
Ncbi
GenBank DQ345363

Tools