TxX precursor (P01056) Protein Card

General Information
Name TxX precursor
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily I2 superfamily
Pharmacological family

Sequence
MSGHTSVSFLLLSIVALGMVATVIC
SCDSEFSSEFCERPEE
SCSCSTHTCCHWARRDQCMKPQRCISAQKGN
GRRRLIHMQK
Sequence region
[1-25]signal sequence
[26-72]mature peptideTxX

References
Brown,M.A., Begley,G.S., Czerwiec,E., Stenberg,L.M., Jacobs,M., Kalume,D.E., Roepstorff,P., Stenflo,J., Furie,B.C. and Furie,B. (2005) Precursors of novel Gla-containing conotoxins contain a carboxy-terminal recognition site that directs gamma-carboxylation Biochemistry 44:9150-9159

Internal links
Nucleic acids Conus textile conotoxin Gla-TxX precursor, mRNA, complete cds
Conus textile I2 superfamily conotoxin TxX precursor, gene, complete cds.
Structure

External links
UniProtKB/Swiss-Prot Q5I4E6
Ncbi Q5I4E6, AAW50949

Tools