SO4 precursor (P01061) Protein Card

General Information
Name SO4 precursor
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor
Notes The sequence regions in the Swiss-Prot card are different from the Kauferstein et al. The positions of the litterature have been here taken into account because the mature peptide correspond to SO4.

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVVIVAVLLLTACQLITADDS
RGTQKHRSLRSTTKVS
K
ATDCIEAGNYCGPTVMKICCGFCSPYSKICMNYPKN
Sequence region
[1-25]signal sequence
[43-78]mature peptideSO4

References
Kauferstein,S., Melaun,C. and Mebs,D. (2005) Direct cDNA cloning of novel conopeptide precursors of the O-superfamily Peptides 26:361-367

Internal links
Nucleic acids Conus striatus mRNA for four-loop conotoxin preproprotein, clone 12
Structure

External links
UniProtKB/Swiss-Prot Q5K0D6
Ncbi Q5K0D6, CAH64845

Tools