Conotoxin-3 precursor (P01077) Protein Card

General Information
Name Conotoxin-3 precursor
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCMMIVAVLFLTASIFITA
DNSRNGIENLPRMRRHEMK
KPKASKLNKR
GCLPDEYFCGFSMIGALLCCSGWCLGICMT
Sequence region
[1-22]signal sequence
[52-81]mature peptideConotoxin-3

References
Kauferstein,S., Melaun,C. and Mebs,D. (2005) Direct cDNA cloning of novel conopeptide precursors of the O-superfamily Peptides 26:361-367

Internal links
Nucleic acids Conus imperialis mRNA for four-loop conotoxin prepropeptide, clone 3
Structure

External links
UniProtKB/Swiss-Prot Q5K0C0
Ncbi Q5K0C0, CAH64861

Tools