conotoxin precursor (P01109) Protein Card

General Information
Name conotoxin precursor
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily S superfamily
Pharmacological family

Sequence
GDCSCEGQICKCGYRVSPGKSGCACTCRNAK

References
Pi,C., Liu,Y., Peng,C., Jiang,X., Liu,J., Xu,B., Yu,X., Yu,Y., Jiang,X., Wang,L., Dong,M., Chen,S. and Xu,A.L. (2006) Analysis of expressed sequence tags from the venom ducts of Conus striatus: focusing on the expression profile of conotoxins Biochimie 88:131-140

Internal links
Nucleic acids Conus striatus putative S-superfamily conotoxin precursor, mRNA, partial cds
Structure

External links
UniProtKB/Swiss-Prot Q45RU7
Ncbi AAZ38459, Q45RU7

Tools