MiK42 precursor (P01111) Protein Card

General Information
Name MiK42 precursor
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCALIVAMLLLTACQLITT
DDFRGRQQYRTARSRTKMQ
NYKIFRLTKR
CDAPNAPCEKFDNDCCDACMLREKQQPICAV
Sequence region
[1-22]signal sequence
[52-82]mature peptideMiK42

References
Luo,S., Zhangsun,D., Feng,J., Wu,Y., Zhu,X. and Hu,Y. (2007) Diversity of the O-superfamily conotoxins from Conus miles J. Pept. Sci. 13:44-53

Internal links
Nucleic acids Conus miles MiK42P mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q3YEG3
Ncbi Q3YEG3, AAZ83751

Tools