TeA53 precursor (P01114) Protein Card

General Information
Name TeA53 precursor
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MQKLTILLLVAAVLMSTQA
LNQEQHQRAKINLLSKRKPPAE
R
WWRWGGCMLWFGRCTKDSECCSNSCDRTYCELARFPSDW
Sequence region
[1-19]signal sequence
[43-81]mature peptideTeA53

References
Luo,S., Zhangsun,D., Zhang,B. and Lin,Q. (0) Novel O-superfamily conotoxins, and their coding polynucleotides and use
Luo,S., Zhangsun,D. and Zhang,B. (0) Hainan O-superfamily peptides

Internal links
Nucleic acids Conus textile TeA53P mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q3YEG0
Ncbi Q3YEG0, AAZ83754

Tools