LeD51 precursor (P01116) Protein Card

General Information
Name LeD51 precursor
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MEKLTILLLVAAVLMSTQA
LVERAGENRSKENIKFLLKRKR
AADR
GMWGKCKDGLTTCLAPSECCSGNCEQNCKMW
Sequence region
[1-19]signal sequence
[46-76]mature peptideLeD51

References
Luo,S., Zhangsun,D., Zhang,B. and Lin,Q. (0) Novel O-superfamily conotoxins, and their coding polynucleotides and use
Luo,S., Zhangsun,D. and Zhang,B. (0) Hainan O-superfamily peptides

Internal links
Nucleic acids Conus litteratus LeD51P mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q3YEF7
Ncbi AAZ83757, Q3YEF7

Tools