BeB42 precursor (P01134) Protein Card

General Information
Name BeB42 precursor
Organism Conus betulinus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVLIIAVLFLTACQLATA
KTYSTGRQKHRALRSTDKN
IKLSRR
CNDPGGSCTRHYHCCQLYCNKQESVCLENEPAF
Sequence region
[1-22]signal sequence
[48-80]mature peptideBeB42

References
Luo,S., Zhangsun,D., Zhang,B. and Lin,Q. (0) Novel O-superfamily conotoxins, and their coding polynucleotides and use
Luo,S., Zhangsun,D., Zhang,B. and Lin,Q. (0) Hainan O-superfamily peptides
Zhangsun, D., Luo, S., Wu, Y., Zhu, X., Hu, Y. and Xie, L. (2006) Novel O-superfamily conotoxins identified by cDNA cloning from three vermivorous Conus species. Chem Biol Drug Des. 68:256-265

Internal links
Nucleic acids Conus betulinus BeB42P mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q3YEG7
Ncbi AAZ83782, Q3YEG7

Tools