LtVIA precursor (P01154) Protein Card

General Information
Name LtVIA precursor
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVLIIAVLFLMDNQLITA
DYPRDEQVYRAVRLR
DAMQ
KSKGSGSCAYISEPCDILPCCPGLKCNEDFVPICL
Sequence region
[1-22]signal sequence
[38-76]mature peptideLtVIA

References
Pi,C., Liu,J., Peng,C., Liu,Y., Jiang,X., Zhao,Y., Tang,S., Wang,L., Dong,M., Chen,S. and Xu,A. (2006) Diversity and evolution of conotoxins based on gene expression profiling of Conus litteratus Genomics 88:809-819

Internal links
Nucleic acids Conus litteratus clone 02C04 O superfamily conotoxin lt6a precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q2I2R4
Ncbi ABC74976, Q2I2R4

Tools