LtVIB precursor (P01155) Protein Card

General Information
Name LtVIB precursor
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTRVLIIAVLFLTAYQLTT
VETYSRGKWMHRALRSTGKN
PKVTR
ECSSPDESCTYHYNCCQLYCNKEENVCLENSPEV
Sequence region
[1-21]signal sequence
[47-80]mature peptideLtVIB

References
Pi,C., Liu,J., Peng,C., Liu,Y., Jiang,X., Zhao,Y., Tang,S., Wang,L., Dong,M., Chen,S. and Xu,A. (2006) Diversity and evolution of conotoxins based on gene expression profiling of Conus litteratus Genomics 88:809-819

Internal links
Nucleic acids Conus litteratus clone 03F07 O superfamily conotoxin lt6b precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q2I2R3
Ncbi Q2I2R3, ABC74977

Tools