SO5 precursor (P01221) Protein Card

General Information
Name SO5 precursor
Alternative name(s) CstrH_3_1
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
VVIVAVLLLTACQLITADDS
RGTQKHRSLRPTTKVSK
STSC
MEAGSYCGSTTRICCGYCAYFGKKCIDYPSN
Sequence region
[1-20]signal sequence
[38-72]mature peptideSO5

References
Duda,T.F. and Palumbi,S.R. (0) Molecular evolution of four-loop conotoxin precursors from fish-eating Conus

Internal links
Nucleic acids Conus striatus isolate CstrH_3_1 four-loop conotoxin precursor, gene, partial cds
Structure

External links
UniProtKB/Swiss-Prot Q9NCU9
Ncbi AAF89911

Tools