Sequence 22 from patent US 6077934 (P01288) Protein Card

General Information
Name Sequence 22 from patent US 6077934
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MGKLTILVLVAAVLLSAQVMVQGDGDQPADRNAVPRDDNPG
GASGKFMNVLRRSGCPWEPWCG
Average Mass 6666.70
Monoisotopic Mass 6662.32
Isoelectric Point 6.78
Extinction Coefficient [280nm] 11250.00

References
Jacobsen,R., Jimenez,E., Cruz,L.J., Olivera,B.M., Gray,W.R., Grilley,M., Watkins,M. and Hillyard,D.R. (2000) Contryphan peptides Patent: US 6077934 20-JUN-2000

Internal links
Nucleic acids Sequence 21 from patent US 6077934
Sequence 21 from patent US 6153738
Structure

External links
Patent Lens US6077934
Ncbi AAE44099

Tools