PVIIA (P01356) Protein Card

General Information
Name PVIIA
Alternative name(s) CGX-1051,Fin-popping peptide,P7a
Organism Conus purpurascens
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor PVIIA precursor (1331)
PVIIA precursor (846)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family kappa conotoxin

Sequence
CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
Modified residues
positionsymbolname
4O4-Hydroxyproline
28nh2C-term amidation
Sequence evidence protein level
Average Mass 3268.78
Monoisotopic Mass 3266.43
Isoelectric Point 11.84
Extinction Coefficient [280nm] NA

Activity

IC50: Voltage-Gated Potassium Channels

TargetOrganismIC50Ref
Kv ShakerD. melanogaster57nM+/-4Jacobsen,R.B. et al. (2000)

Synthetic variants
Cyclic PVIIAGGGTEPLVCKNFRNCKRSCCDDLHQFCKQNOIRC
PVIIA [D13A](nh2)VCKNFRNCKRSCCDALHQFCKQNOIRC
PVIIA [F23A](nh2)VCKNARNCKRSCCDDLHQFCKQNOIRC
PVIIA [F9A](nh2)VCKNFRNCKRSCCDDLHQACKQNOIRC
PVIIA [F9M](nh2)VCKNFRNCKRSCCDDLHQFCKQNOIRC
PVIIA [F9Y](nh2)VCKNFRNCKRSCCDDLHQYCKQNOIRC
PVIIA [H11A](nh2)VCKNFRNCKRSCCDDLAQFCKQNOIRC
PVIIA [I3A](nh2)VCKNFRNCKRSCCDDLHQFCKQNOARC
PVIIA [K19A](nh2)VCKNFRNCARSCCDDLHQFCKQNOIRC
PVIIA [K25A](nh2)VCANFRNCKRSCCDDLHQFCKQNOIRC
PVIIA [K7A](nh2)VCKNFRNCKRSCCDDLHQFCAQNOIRC
PVIIA [K7R](nh2)VCKNFRNCKRSCCDDLHQFCRQNOIRC
PVIIA [N24A](nh2)VCKAFRNCKRSCCDDLHQFCKQNOIRC
PVIIA [Q10A](nh2)VCKNFRNCKRSCCDDLHAFCKQNOIRC
PVIIA [Q6A](nh2)VCKNFRNCKRSCCDDLHQFCKANOIRC
PVIIA [R18A](nh2)VCKNFRNCKASCCDDLHQFCKQNOIRC
PVIIA [R22A](nh2)VCKNFANCKRSCCDDLHQFCKQNOIRC
PVIIA [R2A](nh2)VCKNFRNCKRSCCDDLHQFCKQNOIAC
PVIIA [R2K](nh2)VCKNFRNCKRSCCDDLHQFCKQNOIKC
PVIIA [R2Q](nh2)VCKNFRNCKRSCCDDLHQFCKQNOIQC
PVIIA [S17A](nh2)VCKNFRNCKRACCDDLHQFCKQNOIRC

References
Terlau,H., Shon,K.J., Grilley,M., Stocker,M., Stuhmer,W. and Olivera,B.M. (1996) Strategy for rapid immobilization of prey by a fish-hunting marine snail Nature 381:148-151
Scanlon,M.J., Naranjo,D., Thomas,L., Alewood,P.F., Lewis,R.J. and Craik,D.J. (1997) Solution structure and proposed binding mechanism of a novel potassium channel toxin kappa-conotoxin PVIIA Structure 5:1585-1597
Savarin,P., Guenneugues,M., Gilquin,B., Lamthanh,H., Gasparini,S., Zinn-Justin,S. and Menez,A. (1998) Three-dimensional structure of kappa-conotoxin PVIIA, a novel potassium channel-blocking toxin from cone snails Biochemistry 37:5407-5416
Jacobsen,R.B., Koch,E.D., Lange-Malecki,B., Stocker,M., Verhey,J., Van Wagoner,R.M., Vyazovkina,A., Olivera,B.M. and Terlau,H. (2000) Single amino acid substitutions in kappa-conotoxin PVIIA disrupt interaction with the shaker K+ channel J. Biol. Chem. 275:24639-24644
Naranjo,D. (2002) Inhibition of single Shaker K channels by kappa-conotoxin-PVIIA Biophys. J. 82:3003-3011
Huang,X., Dong,F. and Zhou,H.X. (2005) Electrostatic recognition and induced fit in the kappa-PVIIA toxin binding to Shaker potassium channel. J. Am. Chem. Soc. 127:6836-6849

Internal links
Protein Precursor PVIIA precursor (1331)
PVIIA precursor (846)
Nucleic acids
Structure 3D STRUCTURE OF K-CONOTOXIN PVIIA, A NOVEL POTASSIUM CHANNEL-BLOCKING TOXIN FROM CONE SNAILS, NMR, 22 STRUCTURES
POTASSIUM CHANNEL BLOCKER KAPPA CONOTOXIN PVIIA FROM C. PURPURASCENS, NMR, 20 STRUCTURES

External links
Ncbi 1KCP_A, 1AV3_A, AAQ05864

Tools