Conantokin-G precursor (P01373) Protein Card

General Information
Name Conantokin-G precursor
Alternative name(s) G14
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conantokin
Gene superfamily B1 superfamily
Pharmacological family

Sequence
MHLYTYLYLLVPLVTFHLILG
TGTLDDGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRGNKAR
GE
EELQENQELIREKSN
GKR
Sequence region
[1-21]signal sequence
[81-97]mature peptideConantokin-G

References
Malmberg,A.B., Gilbert,H., McCabe,R.T. and Basbaum,A.I. (2003) Powerful antinociceptive effects of the cone snail venom-derived subtype-selective NMDA receptor antagonists conantokins G and T Pain 101:109-116
Olivera,B.M., Rivier,J., Clark,C., Ramilo,C.A., Corpuz,G.P., Abogadie,F.C., Mena,E.E., Woodward,S.R., Hillyard,D.R. and Cruz,L.J. (1990) Diversity of Conus neuropeptides Science 249:257-263
Klein,R.C., Prorok,M., Galdzicki,Z. and Castellino,F.J. (2001) The amino acid residue at sequence position 5 in the conantokin peptides partially governs subunit-selective antagonism of recombinant N-methyl-D-aspartate receptors J. Biol. Chem. 276:26860-26867
Skjaerbaek,N., Nielsen,K.J., Lewis,R.J., Alewood,P. and Craik,D.J. (1997) Determination of the solution structures of conantokin-G and conantokin-T by CD and NMR spectroscopy J. Biol. Chem. 272:2291-2299
Rigby,A.C., Baleja,J.D., Furie,B.C. and Furie,B. (1997) Three-dimensional structure of a gamma-carboxyglutamic acid-containing conotoxin, conantokin G, from the marine snail Conus geographus: the metal-free conformer Biochemistry 36:6906-6914
Rigby,A.C., Baleja,J.D., Li,L., Pedersen,L.G., Furie,B.C. and Furie,B. (1997) Role of gamma-carboxyglutamic acid in the calcium-induced structural transition of conantokin G, a conotoxin from the marine snail Conus geographus Biochemistry 36:15677-15684
Bandyopadhyay,P.K., Colledge,C.J., Walker,C.S., Zhou,L.M., Hillyard,D.R. and Olivera,B.M. (1998) Conantokin-G precursor and its role in gamma-carboxylation by a vitamin K-dependent carboxylase from a Conus snail J. Biol. Chem. 273:5447-5450
McIntosh,J.M., Olivera,B.M., Cruz,L.J. and Gray,W.R. (1984) Gamma-carboxyglutamate in a neuroactive toxin J. Biol. Chem. 259:14343-14346
Blandl,T., Warder,S.E., Prorok,M. and Castellino,F.J. (1999) Binding of cations to individual gamma-carboxyglutamate residues of conantokin-G and conantokin-T J. Pept. Res. 53:453-464

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P07231
Ncbi P07231

Tools