Conantokin-L precursor (P01374) Protein Card

General Information
Name Conantokin-L precursor
Organism Conus lynceus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conantokin
Gene superfamily B1 superfamily
Pharmacological family

Sequence
MQLYTYLYLLVPLVTFHLILG
TGTLDHGGALTERRSTDAIA
LKPEPVLLQKSSARSTDDNGNDRLTQMKRILKKRGNKAR
GE
EEVAKMAAELAREDAVN
GK
Sequence region
[1-21]signal sequence
[81-99]mature peptideConantokin-L

References
Jimenez,E.C., Donevan,S., Walker,C., Zhou,L.M., Nielsen,J., Cruz,L.J., Armstrong,H., White,H.S. and Olivera,B.M. (2002) Conantokin-L, a new NMDA receptor antagonist: determinants for anticonvulsant potency Epilepsy Res. 51:73-80

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P69745
Ncbi P69745

Tools