Conkunitzin-S1 (P01376) Protein Card

General Information
Name Conkunitzin-S1
Alternative name(s) Conk-S1
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XIV
Pharmacological family

Sequence
KDRPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQG
GNENNFRRTYDCQRTCLYT
Sequence evidence Unknown
Average Mass 6929.63
Monoisotopic Mass 6925.23
Isoelectric Point 11.35
Extinction Coefficient [280nm] 7450.00

References
Dy,C.Y., Buczek,P., Imperial,J.S., Bulaj,G. and Horvath,M.P. (2006) Structure of conkunitzin-S1, a neurotoxin and Kunitz-fold disulfide variant from cone snail. Acta Crystallogr. D Biol. Crystallogr. 62:980-990
Bayrhuber,M., Vijayan,V., Ferber,M., Graf,R., Korukottu,J., Imperial,J., Garrett,J.E., Olivera,B.M., Terlau,H., Zweckstetter,M. and Becker,S. (2005) Conkunitzin-S1 is the first member of a new Kunitz-type neurotoxin family. Structural and functional characterization. J. Biol. Chem. 280:23766-23770

Internal links
Nucleic acids
Structure A 2.4 CRYSTAL STRUCTURE OF CONKUNITZIN-S1, A NOVEL KUNITZ- FOLD CONE SNAIL NEUROTOXIN.

External links
Ncbi 1Y62_A

Tools