Vn6A (P01390) Protein Card

General Information
Name Vn6A
Alternative name(s) Vn
Organism Conus ventricosus
Organism region Eastern Atlantic and Mediterranean
Organism diet molluscivorous
Protein Type Wild type
Notes The name was given by ConoServer, to differentiate the two peptides published by Romeo et al. 2008, which where given the same name. The other peptide was named Vn1a.

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
EDCIAVGQLCVFWNIGRPCCSGLCVFACTVKLP(nh2)
Modified residues
positionsymbolname
34nh2C-term amidation
Sequence evidence protein level
Average Mass 3539.23
Monoisotopic Mass 3536.63
Isoelectric Point 7.00
Extinction Coefficient [280nm] 5500.00

References
Romeo,C., Di Francesco,L., Oliverio,M., Palazzo,P., Massilia,G.R., Ascenzi,P., Polticelli,F. and SchininĂ ,M.E. (2008) Conus ventricosus venom peptides profiling by HPLC-MS: a new insight in the intraspecific variation. J Sep Sci 31:488-498

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P83301
Ncbi P83301

Tools