R11.3 precursor (P01410) Protein Card

General Information
Name R11.3 precursor
Organism Conus radiatus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily I1 superfamily
Pharmacological family

Sequence
MKLCLTFLLVLMILASVTG
EKLSEQTLRRAARKNK
GPRCWV
GRVHCTYHKDCCPSVCCFKGRCKPQSWGCWSGPT
Sequence region
[1-19]signal sequence
[36-75]mature peptideR11.3

References
Buczek,O., Yoshikami,D., Watkins,M., Bulaj,G., Jimenez,E.C. and Olivera,B.M. (2005) Characterization of D-amino-acid-containing excitatory conotoxins and redefinition of the I-conotoxin superfamily FEBS J. 272:4178-4188
Jimenez,E.C., Shetty,R.P., Lirazan,M., Rivier,J., Walker,C., Abogadie,F.C., Yoshikami,D., Cruz,L.J. and Olivera,B.M. (2003) Novel excitatory Conus peptides define a new conotoxin superfamily J. Neurochem. 85:610-621

Internal links
Nucleic acids Conus radiatus conotoxin 11.3 gene, partial cds.
Structure

External links
UniProtKB/Swiss-Prot Q7Z090
Ncbi Q7Z090, ADB93083

Tools