S11.2a (P01419) Protein Card

General Information
Name S11.2a
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily I1 superfamily
Cysteine framework XI
Pharmacological family

Sequence
GCKKDRKPCSYQADCCNCCPIGTCAPSTNWILPGCSTGPFM
AR
Sequence evidence nucleic acid level
Average Mass 4577.27
Monoisotopic Mass 4573.91
Isoelectric Point 10.87
Extinction Coefficient [280nm] 6990.00

References
Buczek,O., Yoshikami,D., Watkins,M., Bulaj,G., Jimenez,E.C. and Olivera,B.M. (2005) Characterization of D-amino-acid-containing excitatory conotoxins and redefinition of the I-conotoxin superfamily FEBS J. 272:4178-4188

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P0C259
Ncbi P0C259

Tools