Fi11.1a (P01421) Protein Card

General Information
Name Fi11.1a
Organism Conus figulinus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Notes The superfamily assignment is not supported by any available data but the cDNA extraction method is based on the conservation of the signal sequence.

Classification
Conopeptide class conotoxin
Gene superfamily I1 superfamily
Cysteine framework XI
Pharmacological family

Sequence
GHVSCGKDGRACDYHADCCNCCLGGICKPSTSWIGCSTNVF
lTR
Modified residues
positionsymbolname
42lD-leucine
Sequence evidence nucleic acid level
Average Mass 4632.21
Monoisotopic Mass 4628.91
Isoelectric Point 9.73
Extinction Coefficient [280nm] 6990.00

References
Buczek,O., Yoshikami,D., Watkins,M., Bulaj,G., Jimenez,E.C. and Olivera,B.M. (2005) Characterization of D-amino-acid-containing excitatory conotoxins and redefinition of the I-conotoxin superfamily FEBS J. 272:4178-4188

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P0C256
Ncbi P0C256

Tools