Ep11.1 precursor (P01453) Protein Card

General Information
Name Ep11.1 precursor
Organism Conus episcopatus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily I1 superfamily
Pharmacological family

Sequence
MKLCVTFLLILVILPSVTG
EKSSKRTLSGAALR
GDWGMCSG
IGQGCGQDSNCCGDMCCYGQICAMTFAACGP
Sequence region
[1-19]signal sequence
[34-72]mature peptideEp11.1

References
Buczek,O., Yoshikami,D., Watkins,M., Bulaj,G., Jimenez,E.C. and Olivera,B.M. (2005) Characterization of D-amino-acid-containing excitatory conotoxins and redefinition of the I-conotoxin superfamily FEBS J. 272:4178-4188

Internal links
Nucleic acids Conus episcopatus conotoxin 11.1 gene, partial cds.
Structure

External links
UniProtKB/Swiss-Prot P0C253
Ncbi P0C253, ADB93079

Tools