Bt11.1 precursor (P01454) Protein Card

General Information
Name Bt11.1 precursor
Organism Conus betulinus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily I1 superfamily
Pharmacological family

Sequence
MKLCVAFLLVLVILPSVIGG
KPSERTLSGATRRGDRR
MCLS
LGQRCERHSNCCGYLCCFYDKCVVTAIGCGHY
Sequence region
[1-20]signal sequence
[38-73]mature peptideBt11.1

References
Buczek,O., Yoshikami,D., Watkins,M., Bulaj,G., Jimenez,E.C. and Olivera,B.M. (2005) Characterization of D-amino-acid-containing excitatory conotoxins and redefinition of the I-conotoxin superfamily FEBS J. 272:4178-4188

Internal links
Nucleic acids Conus betulinus conotoxin 11.1 gene, partial cds.
Structure

External links
UniProtKB/Swiss-Prot P0C251
Ncbi P0C251, ADB93078

Tools