Em11.10 precursor (P01457) Protein Card

General Information
Name Em11.10 precursor
Organism Conus emaciatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily I2 superfamily
Pharmacological family

Sequence
CFPPGIYCTPYLPCCWGICCGTCRNVCHLRI
GKRATFQE
Sequence region
[1-31]mature peptideEm11.10

References
Buczek,O., Yoshikami,D., Watkins,M., Bulaj,G., Jimenez,E.C. and Olivera,B.M. (2005) Characterization of D-amino-acid-containing excitatory conotoxins and redefinition of the I-conotoxin superfamily FEBS J. 272:4178-4188

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P0C252
Ncbi P0C252

Tools