De13a precursor (P01500) Protein Card

General Information
Name De13a precursor
Organism Conus delessertii
Organism region Western Atlantic and Caribbean
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
DCPTRCPTTCANGWECCKGYPCVNKACSGCTH
GK
Sequence region
[1-32]mature peptideDe13a

References
Aguilar,M.B., López-Vera,E., Ortiz,E., Becerril,B., Possani,L.D., Olivera,B.M. and Heimer de la Cotera,E.P. (2005) A novel conotoxin from Conus delessertii with posttranslationally modified lysine residues Biochemistry 44:11130-11136

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P84698
Ncbi P84698

Tools