MrVIB (P01556) Protein Card

General Information
Name MrVIB
Alternative name(s) CGX-1002,Mr051,Mr6b
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor MrVIB precursor (597)
MrVIB precursor (6167)
MrVIB precursor (6186)
Notes Wilson et al. 2011 described the influence of NaV beta subunit on koff.

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family mu conotoxin

Sequence
ACSKKWEYCIVPILGFVYCCPGLICGPFVCV
Sequence evidence protein level
Average Mass 3406.17
Monoisotopic Mass 3403.58
Isoelectric Point 10.31
Extinction Coefficient [280nm] 8480.00

Activity

IC50: Voltage-Gated Sodium Channels

TargetOrganismIC50Ref
Nav1.8R. norvegicus326nMde Araujo,A.D. et al. (2011)
Nav TTX-RR. norvegicus22nMde Araujo,A.D. et al. (2011)
Nav TTX-SR. norvegicus>1uMde Araujo,A.D. et al. (2011)

Percentage inhibition: Voltage-Gated Sodium Channels

TargetOrganism% inhibitionConcentrationRef
Nav1.2R. norvegicus33+/-121uMKnapp,O. et al. (2012)
Nav1.8H. sapiens69+/-31uMKnapp,O. et al. (2012)

Synthetic variants
MrVIB [C19U,C30U]ACSKKWEYCIVPILGFVYUCPGLICGPFVUV
MrVIB [C2U,C20U]AUSKKWEYCIVPILGFVYCUPGLICGPFVCV
MrVIB [C9U,C25U]ACSKKWEYUIVPILGFVYCCPGLIUGPFVCV

References
Daly,N.L., Ekberg,J.A., Thomas,L., Adams,D.J., Lewis,R.J. and Craik,D.J. (2004) Structures of muO-conotoxins from Conus marmoreus. I nhibitors of tetrodotoxin (TTX)-sensitive and TTX-resistant sodium channels in mammalian sensory neurons J. Biol. Chem. 279:25774-25782
Fainzilber,M., van der Schors,R., Lodder,J.C., Li,K.W., Geraerts,W.P. and Kits,K.S. (1995) New sodium channel-blocking conotoxins also affect calcium currents in Lymnaea neurons Biochemistry 34:5364-5371
Wilson,M.J., Zhang,M.M., Azam,L., Olivera,B.M., Bulaj,G. and Yoshikami,D. (2011) NaV{beta} Subunits Modulate the Inhibition of NaV1.8 by the Analgesic Gating Modifier {micro}O-Conotoxin MrVIB. J. Pharmacol. Exp. Ther. 338:687-693
Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329
Knapp,O., Nevin,S.T., Yasuda,T., Lawrence,N., Lewis,R.J. and Adams,D.J. (2012) Biophysical properties of Na(v) 1.8/Na(v) 1.2 chimeras and inhibition by µO-conotoxin MrVIB. Br. J. Pharmacol. 166:2148-2160

Internal links
Protein Precursor MrVIB precursor (597)
MrVIB precursor (6167)
MrVIB precursor (6186)
Nucleic acids
Structure SOLUTION STRUCTURE OF CONOTOXIN MRVIB

External links
Ncbi 1RMK_A, AAB34194

Tools