GVIIIA precursor (P01724) Protein Card

General Information
Name GVIIIA precursor
Alternative name(s) G42
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily S superfamily
Pharmacological family

Sequence
MMSKMGAMFVLLLLFTLASS
LQEGDVQARKTRLKSDFYRAL
ARDDR
GCTRTCGGPKCTGTCTCTNSSKCGCRYNVHPSGWGC
GCACS
G
Sequence region
[1-20]signal sequence
[47-87]mature peptideGVIIIA

References
England,L.J., Imperial,J., Jacobsen,R., Craig,A.G., Gulyas,J., Akhtar,M., Rivier,J., Julius,D. and Olivera,B.M. (1998) Inactivation of a serotonin-gated ion channel by a polypeptide toxin from marine snails Science 281:575-578

Internal links
Nucleic acids Conus geographus conotoxin GVIIIA gene, partial cds.
Structure

External links
UniProtKB/Swiss-Prot P58924
Ncbi ADB93080, P58924

Tools