PnVIB (P01741) Protein Card

General Information
Name PnVIB
Alternative name(s) Pn6b
Organism Conus pennaceus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor PnVIB precursor (1088)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family omega conotoxin

Sequence
DDDCEPPGNFCGMIKIGPPCCSGWCFFACA
Sequence evidence protein level
Average Mass 3178.61
Monoisotopic Mass 3176.17
Isoelectric Point 4.03
Extinction Coefficient [280nm] 5500.00

References
Kits,K.S., Lodder,J.C., van der Schors,R.C., Li,K.W., Geraerts,W.P. and Fainzilber,M. (1996) Novel omega-conotoxins block dihydropyridine-insensitive high voltage-activated calcium channels in molluscan neurons J. Neurochem. 67:2155-2163

Internal links
Protein Precursor PnVIB precursor (1088)
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P56713
Ncbi P56713

Tools