Sequence 6 from patent US 5990295 (P01801) Protein Card

General Information
Name Sequence 6 from patent US 5990295
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MKLTCMMIVAVLFLTAWTLVMADDSNNGLANHFLKSRDEME
DPEASKLEKRACSKKWEYCIVPILGFVYCCPGLICGPFVCV
Average Mass 9210.01
Monoisotopic Mass 9203.48
Isoelectric Point NA
Extinction Coefficient [280nm] 14855.00

References
Shon,K.-J., Olivera,B.M. and McIntosh,J.Michael. (1999) Conotoxin peptides Patent: US 5990295 23-NOV-1999

Internal links
Nucleic acids
Structure

External links
Patent Lens US5990295
Ncbi AAE37887

Tools