Sequence 10 from patent US 5739276 (P01804) Protein Card

General Information
Name Sequence 10 from patent US 5739276
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MKLTCVMIVAVLFLTAWTFVTADDSKNGLENHFWKARDEMK
NREASKLDKKEACYAPGTFCGIKPGLCCSEFCLPGVCFGG
Average Mass 8944.50
Monoisotopic Mass 8938.30
Isoelectric Point NA
Extinction Coefficient [280nm] 13365.00

References
Shon,K.-J., Grilley,M.M. and Olivera,B.M. (1998) Conotoxin peptides Patent: US 5739276 14-APR-1998

Internal links
Nucleic acids
Structure

External links
Patent Lens US5739276
Ncbi AAC84974

Tools