Sequence 6 from patent US 5719264 (P01806) Protein Card

General Information
Name Sequence 6 from patent US 5719264
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MKLTCMMIVAVLFLTAWTLVMADDSNNGLANHFLKSRDEME
DPEASKLEKRACSKKWEYCIVPILGFVYCCPGLICGPFVCV
Average Mass 9210.01
Monoisotopic Mass 9203.48
Isoelectric Point 6.80
Extinction Coefficient [280nm] 14855.00

References
Shon,K.-J., Olivera,B.M., McIntosh,J.Michael., Hasson,A. and Spira,M.E. (1998) Conotoxin peptides Patent: US 5719264 17-FEB-1998
Lavergne,V., Dutertre,S., Jin,A.H., Lewis,R.J. and Alewood,P.F. (2013) Systematic interrogation of the Conus marmoreus venom duct transcriptome with ConoSorter reveals 158 novel conotoxins and 13 new gene superfamilies. BMC Genomics 14:708

Internal links
Nucleic acids
Structure

External links
Patent Lens US5719264
Ncbi BAO02216 (partial), AAC30444

Tools