Sequence 243 from patent US 6762165 (P01993) Protein Card

General Information
Name Sequence 243 from patent US 6762165
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
LNERDCLNVDYFCGIPFVNNGLCCSGNCVFCLHTPREVKLP
Average Mass 4604.34
Monoisotopic Mass 4601.12
Isoelectric Point NA
Extinction Coefficient [280nm] 2240.00

References
Olivera,B.M., Cartier,G.E., Watkins,M., Hillyard,D.R., McIntosh,J.M., Layer,R.T. and Jones,R.M. (2004) O-superfamily conotoxin peptides Patent: US 6762165-A 282 13-JUL-2004; University of Utah Research Foundation and Cognetix, Inc.; Salt Lake City, UT

Internal links
Nucleic acids
Structure

External links
Patent Lens US6762165
Ncbi AAV99611

Tools