Tx6.6 precursor (P02007) Protein Card

General Information
Name Tx6.6 precursor (named by ConoServer)
Alternative name(s) Sequence 222 from patent US 6762165
Organism Unknown
Protein Type Precursor
Notes This sequence was patented.

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVMIVAVLFLTAWTLVMA
DDSNNGLANLFSKLRDEME
DPEGSKLEKK
DCQEKWDYCPVPFLGSRYCCDGFICPSFFCA
Sequence region
[1-22]signal sequence
[52-82]mature peptideTx6.6

References
Olivera,B.M., Cartier,G.E., Watkins,M., Hillyard,D.R., McIntosh,J.M., Layer,R.T. and Jones,R.M. (2004) O-superfamily conotoxin peptides Patent: US 6762165-A 282 13-JUL-2004; University of Utah Research Foundation and Cognetix, Inc.; Salt Lake City, UT

Internal links
Nucleic acids
Structure

External links
Patent Lens US6762165
Ncbi AAV99597

Tools