Sequence 116 from patent US 6762165 (P02076) Protein Card

General Information
Name Sequence 116 from patent US 6762165
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MKLTCMMIVAVLFLTAWTFATADDPRNGLENLFSKAHHEMK
NPKDSKLNKRCLDAGEMCDLFNSKCCSGWCIILFCA
Average Mass 8693.29
Monoisotopic Mass 8687.13
Isoelectric Point 7.88
Extinction Coefficient [280nm] 11875.00

References
Olivera,B.M., Cartier,G.E., Watkins,M., Hillyard,D.R., McIntosh,J.M., Layer,R.T. and Jones,R.M. (2004) O-superfamily conotoxin peptides Patent: US 6762165-A 282 13-JUL-2004; University of Utah Research Foundation and Cognetix, Inc.; Salt Lake City, UT
Lavergne,V., Dutertre,S., Jin,A.H., Lewis,R.J. and Alewood,P.F. (2013) Systematic interrogation of the Conus marmoreus venom duct transcriptome with ConoSorter reveals 158 novel conotoxins and 13 new gene superfamilies. BMC Genomics 14:708

Internal links
Nucleic acids
Structure

External links
Patent Lens US6762165
Ncbi AAV99525, BAO02212

Tools