Sequence 110 from patent US 6762165 (P02080) Protein Card

General Information
Name Sequence 110 from patent US 6762165
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MKLTCVMIIAVLFLTAWTFATADDSGNGLENLFSKAHHEMK
NPKASKLNKRCTQSGELCDVIDPDCCNNFCIIFFCI
Average Mass 8592.06
Monoisotopic Mass 8586.11
Isoelectric Point 6.75
Extinction Coefficient [280nm] 6375.00

References
Olivera,B.M., Cartier,G.E., Watkins,M., Hillyard,D.R., McIntosh,J.M., Layer,R.T. and Jones,R.M. (2004) O-superfamily conotoxin peptides Patent: US 6762165-A 282 13-JUL-2004; University of Utah Research Foundation and Cognetix, Inc.; Salt Lake City, UT
Hillyard, D.R., Mcintosh, M.J., Jones, R.M., Cartier, E.G., Watkins, M., Olivera, B.M. and Layer, R.T. (2003) O-Superfamily Conotoxin Peptides Patent: JP 2003533178-A 1 11-NOV-2003;

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P0CB10
Patent Lens US6762165
Ncbi P0CB10, AAV99521

Tools