SmIVA precursor (P00021) Protein Card

General Information
Name SmIVA precursor
Organism Conus stercusmuscarum
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Pharmacological family

Sequence
MGMRMMFTVFLLVVLATTVVS
IPSDRASDGRNAAVNER
QTW
LVPSTITTCCGYDPGTMCPTCMCDNTCKPKPKKS
GRRND
Sequence region
[1-21]signal sequence
[39-75]mature peptideSmIVA

References
Santos,A.D., McIntosh,J.M., Hillyard,D.R., Cruz,L.J. and Olivera,B.M. (2004) The A-superfamily of conotoxins: structural and functional divergence J. Biol. Chem. 279:17596-17606

Internal links
Nucleic acids Conus stercusmuscarum isolate SmVIII superfamily conotoxin gene, complete cds.
Structure

External links
UniProtKB/Swiss-Prot P0C1Y3
Ncbi ACZ49784, P0CE75

Tools