Sequence 408 from patent US 6767895 (P02180) Protein Card

General Information
Name Sequence 408 from patent US 6767895
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
GHVSCGKDGRACDYHADCCNCCLGGICKPSTSWIGCSTNVF
LTR
Average Mass 4640.27
Monoisotopic Mass 4636.97
Isoelectric Point NA
Extinction Coefficient [280nm] 7990.00

References
Walker,C.S., Shetty,R., Jimenez,E.C., McIntosh,J.M., Olivera,B.M., Watkins,M., Jones,R.M. and Shen,G.S. (2004) I-superfamily conotoxins Patent: US 6767895-A 440 27-JUL-2004; Cognetix, Inc. and University of Utah Research Foundation; Salt Lake City, UT

Internal links
Nucleic acids
Structure

External links
Patent Lens US6767895
Ncbi AAV25568

Tools