Sequence 391 from patent US 6767895 (P02182) Protein Card

General Information
Name Sequence 391 from patent US 6767895
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
GPSFCKADEKPCEYHADCCNCCLSGICAPSTNWILPGCSTS
SFFKI
Average Mass 4935.64
Monoisotopic Mass 4932.09
Isoelectric Point NA
Extinction Coefficient [280nm] 7990.00

References
Walker,C.S., Shetty,R., Jimenez,E.C., McIntosh,J.M., Olivera,B.M., Watkins,M., Jones,R.M. and Shen,G.S. (2004) I-superfamily conotoxins Patent: US 6767895-A 440 27-JUL-2004; Cognetix, Inc. and University of Utah Research Foundation; Salt Lake City, UT

Internal links
Nucleic acids
Structure

External links
Patent Lens US6767895
Ncbi AAV25551

Tools