Sequence not correctly entered

Sequence 25 from patent US 5595972 (P02356) Protein Card

General Information
Name Sequence 25 from patent US 5595972
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
QKELVPSVITTCCGYDPGTMCPPCRCTNSCPTKPKKPX
Average Mass NA
Monoisotopic Mass NA
Isoelectric Point NA
Extinction Coefficient [280nm] NA

References
Olivera,B.M., Cruz,L.J., Hillyard,D.R., McIntosh,J.Michael. and Santos,A.D. (1996) Conotoxin peptides Patent: US 5514774 07-MAY-1996

Internal links
Nucleic acids
Structure

External links
Patent Lens US5595972
Ncbi AAB46129

Tools