Sequence 35 from patent US 5589340 (P02401) Protein Card

General Information
Name Sequence 35 from patent US 5589340
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
QKSLVPSVITTCCGYDPGTMCPPCRCTNSC
Average Mass 3165.70
Monoisotopic Mass 3163.34
Isoelectric Point NA
Extinction Coefficient [280nm] 2240.00

References
Olivera,B.M., Cruz,L.J., Hillyard,D.R., McIntosh,J.Michael. and Santos,A.D. (1996) Process and primers for identifying nucleic acids encoding A-lineage conotoxin peptides Patent: US 5589340 31-DEC-1996

Internal links
Nucleic acids
Structure

External links
Patent Lens US5589340
Ncbi AAB45025

Tools