Sequence 40 from patent US 5514774 (P02440) Protein Card

General Information
Name Sequence 40 from patent US 5514774
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MGMRMMFTVFLLVVLATNVVSTPSDRASDGRNAAVHERQKS
LVPSVITTCCGYDPGTMCPPCRCTNSCG
Average Mass 7385.63
Monoisotopic Mass 7380.45
Isoelectric Point NA
Extinction Coefficient [280nm] 2240.00

References
Olivera,B.M., Cruz,L.J., Hillyard,D.R., McIntosh,J.Michael. and Santos,A.D. (1996) Conotoxin peptides Patent: US 5514774 07-MAY-1996

Internal links
Nucleic acids
Structure

External links
Patent Lens US5514774
Ncbi AAB12480

Tools