ABVIA (P02484) Protein Card

General Information
Name ABVIA
Organism Conus abbreviatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor ABVIA precursor (1028)
ABVIA precursor (1016)
ABVIA precursor (1024)
ABVIA precursor (1026)
ABVIA precursor (1025)
Notes this sequence was directly derived fron the precursor: some postranslational modifications may be missing.

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CSPPGSYCFGPAACCSNFCSTLSDVCQESWSG
Sequence evidence nucleic acid level
Average Mass 3288.57
Monoisotopic Mass 3286.19
Isoelectric Point 3.28
Extinction Coefficient [280nm] 6990.00

References
Duda,T.F. Jr. and Palumbi,S.R. (1999) Molecular genetics of ecological diversification: duplication and rapid evolution of toxin genes of the venomous gastropod Conus Proc. Natl. Acad. Sci. U.S.A. 96:6820-6823

Internal links
Protein Precursor ABVIA precursor (1028)
ABVIA precursor (1016)
ABVIA precursor (1024)
ABVIA precursor (1026)
ABVIA precursor (1025)
Nucleic acids
Structure

External links
Ncbi AAD48306

Tools