TxO6 (P02558) Protein Card

General Information
Name TxO6
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor TxO6 precursor (873)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
NYCQEKWDYCPVPFLGSRYCCDGLFCTLFFCA
Sequence evidence protein level
Average Mass 3787.34
Monoisotopic Mass 3784.54
Isoelectric Point 6.71
Extinction Coefficient [280nm] 9970.00

References
Lu,B.S., Yu,F., Zhao,D., Huang,P.T. and Huang,C.F. (1999) Conopeptides from Conus striatus and Conus textile by cDNA cloning Peptides 20:1139-1144
Bhatia,S., Kil,Y.J., Ueberheide,B., Chait,B.T., Tayo,L., Cruz,L., Lu,B., Yates,J.R. 3rd. and Bern,M. (2012) Constrained de novo sequencing of conotoxins. J. Proteome Res. 11:4191-4200

Internal links
Protein Precursor TxO6 precursor (873)
Nucleic acids
Structure

External links
Ncbi Q9XZL3, AAD31919

Tools