PuIA (P02602) Protein Card

General Information
Name PuIA
Alternative name(s) Pu1a
Organism Conus pulicarius
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor PuIA precursor (875)
PuIA precursor (5622)
Notes This sequence was directly derived from the precursor: some post-translational modifications may be missing.
The name of this conotoxin does not follow the standard nomenclature. Indeed its cystein pattern doe not correspond to framework I.

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
RDCRPVGQYCGIPYEHNWRCCSQLCAIICVS
Sequence evidence nucleic acid level
Average Mass 3568.11
Monoisotopic Mass 3565.54
Isoelectric Point 9.19
Extinction Coefficient [280nm] 8480.00

References
Zhao,D. and Huang,P. (2000) Cloning of novel conotoxin precursor sequences from Conus pulicarius. Progress in Natural Science 10:33-36

Internal links
Protein Precursor PuIA precursor (875)
PuIA precursor (5622)
Nucleic acids
Structure

External links
Ncbi Q9XYZ0, AAD33585

Tools