LvVIA 1 (P02611) Protein Card

General Information
Name LvVIA 1
Organism Conus lividus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor LvVIA 1 precursor (880)
LvVIA 1 precursor (882)
LvVIA 1 precursor (883)
LvVIA 1 precursor (889)
LvVIA 1 precursor (929)
LvVIA 1 precursor (933)
LvVIA 1 precursor (936)
Notes this sequence was directly derived from the precursor: some post-translational modifications may be missing.

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
TCSPAGEVCTSKSPCCTGFLCSHIGGMCHH
Sequence evidence nucleic acid level
Average Mass 3048.47
Monoisotopic Mass 3046.18
Isoelectric Point 8.75
Extinction Coefficient [280nm] NA

References
Duda,T.F. Jr. and Palumbi,S.R. (1999) Molecular genetics of ecological diversification: duplication and rapid evolution of toxin genes of the venomous gastropod Conus Proc. Natl. Acad. Sci. U.S.A. 96:6820-6823

Internal links
Protein Precursor LvVIA 1 precursor (880)
LvVIA 1 precursor (882)
LvVIA 1 precursor (883)
LvVIA 1 precursor (889)
LvVIA 1 precursor (929)
LvVIA 1 precursor (933)
LvVIA 1 precursor (936)
Nucleic acids
Structure

External links
Ncbi AAD48163

Tools