Conotoxin-3 (P02648) Protein Card

General Information
Name Conotoxin-3
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Conotoxin-3 precursor (1077)
Notes this sequence was directly derived from the precursor: some post-translational modifications may be missing.

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
GCLPDEYFCGFSMIGALLCCSGWCLGICMT
Sequence evidence nucleic acid level
Average Mass 3188.79
Monoisotopic Mass 3186.26
Isoelectric Point 3.39
Extinction Coefficient [280nm] 6990.00

References
Kauferstein,S., Melaun,C. and Mebs,D. (2005) Direct cDNA cloning of novel conopeptide precursors of the O-superfamily Peptides 26:361-367

Internal links
Protein Precursor Conotoxin-3 precursor (1077)
Nucleic acids
Structure

External links
Ncbi Q5K0C0, CAH64861

Tools